- CCDC19 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91757
- CCDC19
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: VDESLFGDIK SPAQGQSDSP IVLLRDKHTL QKTLTALGLD RKPETIQLIT RDMVRELIVP TEDPSGESLI ISPEEFERIK WAS
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- CCDC19, HTX11, NESG1
- cilia and flagella associated protein 45
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
Specifications/Features
Available conjugates: Unconjugated